Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

Search Within Results

106 – 120 of 1,548,612 results

106

Invitrogen™ PSAT1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q99K85, Q9Y617
Isotype	IgG
Concentration	0.23 mg/mL
Antigen	PSAT1
Gene Symbols	PSAT1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	D8Ertd814e; endometrial progesterone-induced protein; EPIP; NLS2; Phosphohydroxythreonine aminotransferase; phosphoserine aminotransferase; phosphoserine aminotransferase 1; PSA; Psa1; Psat; Psat1; PSATD
Gene	PSAT1
Product Type	Antibody
Gene ID (Entrez)	107272, 29968
Formulation	PBS with 1% BSA, 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Recombinant protein encompassing a sequence within the center region of human PSAT1. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

107

Invitrogen™ 6x-His Tag Monoclonal Antibody (HIS.H8), Alexa Fluor™ 488

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, do not freeze
Target Species	Tag
Host Species	Mouse
Conjugate	Alexa Fluor 488
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Isotype	IgG2b
Concentration	1 mg/mL
Antigen	6x-His Tag
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	6His tag; 6X His; His Tag; Histidine Tag
Product Type	Antibody
Formulation	PBS with 1mg/mL BSA and 0.05% sodium azide
Immunogen	6x His synthetic peptide.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	HIS.H8

108

Invitrogen™ SERCA2 ATPase Monoclonal Antibody (IID8)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Bovine,Canine,Human,Mouse,Pig,Rabbit,Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	O46674, O55143, P11507, P11607, P16615, P20647
Isotype	IgG1
Concentration	1 mg/mL
Antigen	SERCA2 ATPase
Gene Symbols	Atp2a2
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	9530097L16Rik; ATP2; Atp2a2; ATP2B; ATPase Ca++ transporting cardiac muscle slow twitch 2; ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2; ATPase, Ca++ dependent, slow-twitch, cardiac muscle-2; ATPase, Ca++ transporting, cardiac muscle, slow twitch 2; ATPase, Ca++ transporting, slow twitch 2; Ca(2+)-transport ATPase class 3; calcium ATPase; calcium pump 2; calcium-ATPase (EC 3.6.1.3); calcium-transporting ATPase; calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletal muscle isoform; cardiac Ca2+ ATPase; D5Wsu150e; DAR; DD; endoplasmic reticulum class 1/2 Ca(2+) ATPase; mKIAA4195; putative SERCA isoform; sarco(endo)plasmic reticulum Ca(2+)-dependent ATPase 2; sarco/endoplasmic reticulum Ca2+-ATPase 2; sarcoplasmic reticulum Ca2+-transport ATPase isoform; sarcoplasmic/endoplasmic reticulum calcium ATPase 2; sarcoplasmic/endoplasmic-reticulum Ca(2+) pump gene 2; SERCA; SERCA ATPase; SERCA2; Serca2a; SERCA2B; SercaII; SR Ca(2+)-ATPase 2; unnamed protein product
Gene	Atp2a2
Product Type	Antibody
Gene ID (Entrez)	100038308, 11938, 29693, 396875, 403878, 488, 540568
Formulation	PBS with 0.05% sodium azide
Immunogen	Purified canine cardiac sarcoplasmic reticulum.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	IID8

109

Invitrogen™ SERCA2 ATPase Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Lyophilized
Gene Accession No.	O55143, P11507, P16615
Isotype	IgG
Concentration	500 μg/mL
Antigen	SERCA2 ATPase
Gene Symbols	Atp2a2
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	9530097L16Rik; ATP2; Atp2a2; ATP2B; ATPase Ca++ transporting cardiac muscle slow twitch 2; ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2; ATPase, Ca++ dependent, slow-twitch, cardiac muscle-2; ATPase, Ca++ transporting, cardiac muscle, slow twitch 2; ATPase, Ca++ transporting, slow twitch 2; Ca(2+)-transport ATPase class 3; calcium ATPase; calcium pump 2; calcium-ATPase (EC 3.6.1.3); calcium-transporting ATPase; calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletal muscle isoform; cardiac Ca2+ ATPase; D5Wsu150e; DAR; DD; endoplasmic reticulum class 1/2 Ca(2+) ATPase; mKIAA4195; putative SERCA isoform; sarco(endo)plasmic reticulum Ca(2+)-dependent ATPase 2; sarco/endoplasmic reticulum Ca2+-ATPase 2; sarcoplasmic reticulum Ca2+-transport ATPase isoform; sarcoplasmic/endoplasmic reticulum calcium ATPase 2; sarcoplasmic/endoplasmic-reticulum Ca(2+) pump gene 2; SERCA; SERCA ATPase; SERCA2; Serca2a; SERCA2B; SercaII; SR Ca(2+)-ATPase 2; unnamed protein product
Gene	Atp2a2
Product Type	Antibody
Gene ID (Entrez)	11938, 29693, 488
Formulation	PBS with 4mg trehalose and no preservative
Immunogen	A synthetic peptide corresponding to a sequence at the N-terminus of human SERCA2 ATPase (1-32aa MENAHTKTVEEVLGHFGVNESTGLSLEQVKKL).
Classification	Polyclonal
Primary or Secondary	Primary

110

Invitrogen™ Blood Group A Antigen Monoclonal Antibody (HE-195)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, do not freeze
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P16442
Isotype	IgM
Concentration	1 mg/mL
Antigen	Blood Group A Antigen
Gene Symbols	ABO
Regulatory Status	RUO
Purification Method	Sequential Chromatography
Gene Alias	A transferase; A1-specific alpha 1-3-N-acetylgalactosaminyltransferase; A3GALNT; A3GALT1; ABO; ABO A3 transferase; ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase); ABO glycosyltransferase; ABO weak transfer; B transferase; B(A) alpha-1,3-galactosyltransferase; Blood Group A1; Blood Group A2; Blood Group A3; fucosylglycoprotein; fucosylglycoprotein 3-alpha-galactosyltransferase; Fucosylglycoprotein alpha-N-acetylgalactosaminyltransferase; Fucosylglycoprotein alpha-N-acetylgalactosaminyltransferase soluble form; Glycoprotein-fucosylgalactoside alpha-galactosyltransferase; glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase; glycosyltransferase A; glycosyltransferase B; GTB; histo-blood group A transferase; histo-blood group A2 transferase; histo-blood group ABO system transferase; Histo-blood group B transferase; NAGAT; Transferase; transferase A
Gene	ABO
Product Type	Antibody
Gene ID (Entrez)	28
Formulation	TBS with 15 mM sodium azide; pH 8
Immunogen	Mixture of erythrocytes of group A1 and glycoprotein fraction isolated from saliva of secretors with blood group A.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	HE-195

111

Invitrogen™ DYKDDDDK Tag Monoclonal Antibody (L5)

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Tag
Host Species	Rat
Conjugate	Unconjugated
Applications	ELISA,Western Blot
Form	Liquid
Isotype	IgG2a
Concentration	1 mg/mL
Antigen	DYKDDDDK Tag
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	DDDDK; DDDDK epitope tag; ECS epitope tag; ECS tag; FLAG; FLAG Tag
Product Type	Antibody
Formulation	PBS with no preservative
Immunogen	Recombinant fusion proteins of mouse Langerin/CD207.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	L5

112

Invitrogen™ IL-10 Monoclonal Antibody (16E3)

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Mouse
Host Species	Rat
Conjugate	Unconjugated
Applications	ELISA,Western Blot
Form	Liquid
Gene Accession No.	P18893
Isotype	IgG2b
Concentration	1.0 mg/mL
Antigen	IL-10
Gene Symbols	IL10
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	CSIF; cytokine; Cytokine synthesis inhibitory factor; GVHDS; H-IL-10; il 10; IL10; IL-10; IL-10 precursor; IL10A; IL10X; ILN; Interleukin; interleukin 10; Interleukin10; interleukin-10; MGC126450; MGC126451; RP11-262N9.1; T-cell growth inhibitory factor; TGIF
Gene	IL10
Product Type	Antibody
Gene ID (Entrez)	16153
Formulation	PBS with no preservative
Immunogen	Recombinant mouse IL-10.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	16E3

113

MAP2 Antibody, Novus Biologicals™

Chicken Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate	Unconjugated
Target Species	Human,Mouse,Rat,Feline
Host Species	Chicken
Applications	Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin),Immunohistochemistry (Frozen),KnockDown
Form	Precipitation
Isotype	IgY
Antigen	MAP2
Regulatory Status	RUO
Purification Method	Ammonium sulfate precipitation
Gene Alias	DKFZp686I2148, MAP-2, MAP2A, MAP2B, MAP2C, Microtubule Associated Protein 2, microtubule-associated protein 2, MTAP2
Formulation	Supplied as concentrated IgY in PBS with 5mM Sodium Azide
Gene ID (Entrez)	4133
Classification	Polyclonal
Immunogen	This MAP2 antibody was developed against a mix of recombinant human construct of projection domain sequences, amino acids 377-1505: Prot-r-MAP2-P1, Prot-r-MAP2-P2 and Prot-r-MAP2-P3.
Primary or Secondary	Primary

114

Invitrogen™ Sarcomeric alpha Actinin Monoclonal Antibody (EA-53)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human,Mouse,Rat,Rabbit,Zebrafish
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunohistochemistry (Frozen),Immunohistochemistry (Free Floating),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P12814, Q7TPR4, Q9Z1P2
Isotype	IgG1
Concentration	Conc. Not Determined
Antigen	Sarcomeric alpha Actinin
Gene Symbols	ACTN1
Regulatory Status	RUO
Gene Alias	3110023F10Rik; actinin 1 smooth muscle; actinin alpha 1; actinin, alpha 1; ACTN1; Actn1a; alpha actinin 1a; alpha-actinin cytoskeletal isoform; Alpha-actinin-1; BDPLT15; F-actin cross-linking protein; non-muscle alpha-actinin 1; non-muscle alpha-actinin-1
Gene	ACTN1
Product Type	Antibody
Gene ID (Entrez)	100341378, 109711, 560400, 81634, 87
Formulation	Ascites with 0.09% sodium azide
Immunogen	Purified rabbit skeletal alpha-actinin.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	EA-53

115

Invitrogen™ CD138 Monoclonal Antibody (MI15)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, do not freeze
Target Species	Human,Monkey,Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot
Form	Liquid
Gene Accession No.	P18827
Isotype	IgG1 κ
Concentration	1 mg/mL
Antigen	CD138
Gene Symbols	Sdc1
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	AA408134; AA409076; CD antigen 138; CD138; CD138 antigen; heparan sulfate proteoglycan fibroblast growth factor receptor; HSPG; sCD138; SDC; Sdc1; soluble CD138; Sstn; syn-1; Synd; SYND1; Synd-1; SYNDECA; syndecan; syndecan 1; syndecan proteoglycan 1; Syndecan1; syndecan-1; synstatin
Gene	Sdc1
Product Type	Antibody
Gene ID (Entrez)	6382
Formulation	PBS with 15mM sodium azide; pH 7.4
Immunogen	A mixture of U266 and XG-1 human myeloma cell lines.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	MI15

116

Invitrogen™ GAPDH Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, do not freeze
Target Species	Human,Mouse,Rat,Monkey,Chicken
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	O14556, P00356, P04406, P04797, P16858, Q64467, Q9ESV6
Isotype	IgG
Concentration	0.2 mg/mL
Antigen	GAPDH
Gene Symbols	GAPDH, GAPDHS
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	38 kDa BFA-dependent ADP-ribosylation substrate; aging-associated gene 9 protein; BARS-38; bb02e05; cb350; cb609; CDABP0047; EC 1.2.1.12; epididymis secretory protein Li 278; epididymis secretory sperm binding protein Li 162eP; fb71f08; fk58c09; G3PD; G3PDH; GAPD; GAPD2; gapdh; GAPDH2; GAPDH-2; GAPDHS; Gapds; Gapd-s; glceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate dehydrogenase; glyceraldehyde 3-phosphate dehydrogenase, testis-specific; glyceraldehyde phosphate dehydrogenase; glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde-3-phosphate dehydrogenase (G3PDH); glyceraldehyde-3-phosphate dehydrogenase 2; glyceraldehyde-3-phosphate dehydrogenase GAPDH; glyceraldehyde-3-phosphate dehydrogenase like-17 protein; glyceraldehyde-3-phosphate dehydrogenase type 2; glyceraldehyde-3-phosphate dehydrogenase, spermatogenic; glyceraldehyde-3-phosphate dehydrogenase, testis-specific; glyceraldehyde-phosphate-dehydrogenase; glycerine aldehyde 3-phosphate dehydrogenase; HEL-S-162eP; HEL-S-278; HGNC:4141; HSD35; HSD-35; I79_001391; KNC-NDS6; LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase, testis-specific; mg:bb02e05; MGC128279 protein; MGC88685; multifunctional protein, glycolytic enzyme; OK/SW-cl.12; Peptidyl-cysteine S-nitrosylase GAPDH; similar to glyceraldehyde 3-phosphate dehydrogenase; spermatogenic cell-specific glyceraldehyde 3-phosphate dehydrogenase 2; Spermatogenic glyceraldehyde-3-phosphate dehydrogenase; Unknown (protein for IMAGE:8101613); unnamed protein product; wu:fb33a10; wu:fb71f08; wu:fk58c09; wu:ft80f05; zgc:76908
Gene	GAPDHS
Product Type	Antibody
Gene ID (Entrez)	14433, 14447, 24383, 2597, 26330, 374193, 66020
Formulation	TBS with 0.1% BSA and 0.09% sodium azide
Immunogen	Residues 150 and 200 of human GAPDH.
Classification	Polyclonal
Primary or Secondary	Primary

117

Invitrogen™ Sialosyl-Tn Antigen Monoclonal Antibody (STn 219)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, do not freeze
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunohistochemistry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Isotype	IgG1
Concentration	0.2 mg/mL
Antigen	Sialosyl-Tn Antigen
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	CD175s
Product Type	Antibody
Formulation	PBS with 1% BSA and 0.05% sodium azide; pH 7.2
Immunogen	Ovine submaxillary mucin (OSM).
Classification	Monoclonal
Primary or Secondary	Primary
Clone	STn 219

118

Invitrogen™ EEA1 Monoclonal Antibody (F.43.1)

Rabbit Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q15075, Q8BL66
Isotype	IgG
Concentration	44 μg/mL
Antigen	EEA1
Gene Symbols	EEA1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	A430109M19Rik; B230358H09Rik; Early endosome antigen 1; early endosome antigen 1, 162kD; early endosome-associated protein; EEA1; Endosome-associated protein p162; MST105; MSTP105; ZFYVE2; Zinc finger FYVE domain-containing protein 2
Gene	EEA1
Product Type	Antibody
Gene ID (Entrez)	216238, 314764, 8411
Formulation	0.01M HEPES with 0.15M NaCl, 100 μg/mL BSA, 50% glycerol and <0.02% sodium azide, pH 7.5
Immunogen	Synthetic peptide corresponding to residues surrounding Ser70 of human EEA1 protein.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	F.43.1

119

Invitrogen™ Vimentin Monoclonal Antibody (SP20)

Rabbit Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P08670, P20152
Isotype	IgG
Concentration	0.006 mg/mL
Antigen	Vimentin
Gene Symbols	Vim
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	cb28; class-III intermediate microfilament; CTRCT30; epididymis luminal protein 113; FLJ36605; Hel113; intermediate filament; intermediate filament protein; RP11-124N14.1; similar to vimentin; VIM; VIME; Vimentin; vimentin C-terminus
Gene	Vim
Product Type	Antibody
Gene ID (Entrez)	22352, 7431
Formulation	PBS with 1% BSA and 0.1% sodium azide; pH 7.20
Immunogen	Recombinant human vimentin protein.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	SP20

120

Invitrogen™ GLUT1 Recombinant Rabbit Monoclonal Antibody (SA0377)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry,Western Blot
Form	Liquid
Gene Accession No.	P11166, P11167, P17809
Isotype	IgG
Concentration	1 mg/mL
Antigen	GLUT1
Gene Symbols	SLC2A1
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	choreoathetosis/spasticity, episodic (paroxysmal choreoathetosis/spasticity); CSE; DYT17; DYT18; DYT9; EIG12; glucose transporter glut1; glucose transporter type 1, erythrocyte/brain; glucose transporter type I; GLUT; Glut1; Glut-1; GLUT1DS; GLUTB; GT1; GTG1; Gtg3; HepG2 glucose transporter; HTLVR; human T-cell leukemia virus (I and II) receptor; MGC141895; MGC141896; PED; RATGTG1; receptor for HTLV-1 and HTLV-2; SDCHCN; Slc2a1; solute carrier family 2 (facilitated glucose transporter), member 1; Solute carrier family 2 a 1 (facilitated glucose transporter) brain; solute carrier family 2 member 1; solute carrier family 2, facilitated glucose transporter member 1; solute carrier family 2, member 1
Gene	SLC2A1
Product Type	Antibody
Gene ID (Entrez)	20525, 24778, 6513
Formulation	TBS with 40% Glycerol, 0.05% BSA and 0.05% sodium azide; pH 7.4
Immunogen	Synthetic peptide within Human GLUT1 aa 443-492.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	SA0377

Prev
1
...
6
7
8
9
...
103,241
Next

Primary Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ PSAT1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ 6x-His Tag Monoclonal Antibody (HIS.H8), Alexa Fluor™ 488 Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ SERCA2 ATPase Monoclonal Antibody (IID8) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ SERCA2 ATPase Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Blood Group A Antigen Monoclonal Antibody (HE-195) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ DYKDDDDK Tag Monoclonal Antibody (L5) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ IL-10 Monoclonal Antibody (16E3) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

MAP2 Antibody, Novus Biologicals™ Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Invitrogen™ Sarcomeric alpha Actinin Monoclonal Antibody (EA-53) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD138 Monoclonal Antibody (MI15) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ GAPDH Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Sialosyl-Tn Antigen Monoclonal Antibody (STn 219) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ EEA1 Monoclonal Antibody (F.43.1) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Vimentin Monoclonal Antibody (SP20) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ GLUT1 Recombinant Rabbit Monoclonal Antibody (SA0377) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ PSAT1 Polyclonal Antibody

Invitrogen™ 6x-His Tag Monoclonal Antibody (HIS.H8), Alexa Fluor™ 488

Invitrogen™ SERCA2 ATPase Monoclonal Antibody (IID8)

Invitrogen™ SERCA2 ATPase Polyclonal Antibody

Invitrogen™ Blood Group A Antigen Monoclonal Antibody (HE-195)

Invitrogen™ DYKDDDDK Tag Monoclonal Antibody (L5)

Invitrogen™ IL-10 Monoclonal Antibody (16E3)

MAP2 Antibody, Novus Biologicals™

Invitrogen™ Sarcomeric alpha Actinin Monoclonal Antibody (EA-53)

Invitrogen™ CD138 Monoclonal Antibody (MI15)

Invitrogen™ GAPDH Polyclonal Antibody

Invitrogen™ Sialosyl-Tn Antigen Monoclonal Antibody (STn 219)

Invitrogen™ EEA1 Monoclonal Antibody (F.43.1)

Invitrogen™ Vimentin Monoclonal Antibody (SP20)

Invitrogen™ GLUT1 Recombinant Rabbit Monoclonal Antibody (SA0377)